SCOP 1.63: Domain d1cqxb1: 1cqx B:1-150

Lineage for d1cqxb1 (1cqx B:1-150)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Flavohemoglobin, N-terminal domain [46528] (2 species)

7. Species Alcaligenes eutrophus [TaxId:106590] [46529] (1 PDB entry)

8. Domain d1cqxb1: 1cqx B:1-150 [15636]
   Other proteins in same PDB: d1cqxa2, d1cqxa3, d1cqxb2, d1cqxb3
   complexed with dgg, fad, hem, na

Details for d1cqxb1

PDB Entry: 1cqx, 1.75 Å

PDB Description: crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution

SCOP Domain Sequences for d1cqxb1:

Sequence; same for both SEQRES and ATOM records:

>d1cqxb1 a.1.1.2 (B:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus}
mltqktkdivkatapvlaehgydiikcfyqrmfeahpelknvfnmahqeqgqqqqalara
vyayaeniedpnslmavlkniankhaslgvkpeqypivgehllaaikevlgnaatddiis
awaqaygnladvlmgmeselyersaeqpgg

Timeline for d1cqxb1:

• d1cqxb1 first appeared (with stable ids) in SCOP 1.55
  
• d1cqxb1 appears in SCOP 1.61
  
• d1cqxb1 appears in SCOP 1.65
  
• d1cqxb1 appears in the current release, SCOPe 2.08