Lineage for d3ccm11 (3ccm 1:1-56)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648151Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2648286Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2648433Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2648464Domain d3ccm11: 3ccm 1:1-56 [156332]
    Other proteins in same PDB: d3ccm21, d3ccmb1, d3ccmf1, d3ccmh1, d3ccmi1, d3ccmp1, d3ccmr1, d3ccms1, d3ccmy1, d3ccmz1
    automatically matched to d1w2bz_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccm11

PDB Entry: 3ccm (more details), 2.55 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
PDB Compounds: (1:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d3ccm11:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccm11 i.1.1.2 (1:1-56) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d3ccm11:

Click to download the PDB-style file with coordinates for d3ccm11.
(The format of our PDB-style files is described here.)

Timeline for d3ccm11: