Lineage for d1hlb__ (1hlb -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (17 proteins) 
Protein Hemoglobin [46524] (1 species) Species Sea cucumber (Caudina (Molpadia) arenicola) [46525] (2 PDB entries) 
Domain d1hlb__: 1hlb - [15625]
Details for d1hlb__
PDB Entry: 1hlb (more details), 2.5 Å
PDB Description: structural analysis of monomeric hemichrome and dimeric cyanomet hemoglobins from caudina arenicola
SCOP Domain Sequences for d1hlb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hlb__ a.1.1.2 (-) Hemoglobin {Sea cucumber (Caudina (Molpadia) arenicola)}
ggtlaiqaqgdltlaqkkivrktwhqlmrnktsfvtdvfirifaydpsaqnkfpqmagms
asqlrssrqmqahairvssimseyveeldsdilpellatlarthdlnkvgadhynlfakv
lmealqaelgsdfnektrdawakafsvvqavllvkhg
SCOP Domain Coordinates for d1hlb__:
Click to download the PDB-style file with coordinates for d1hlb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hlb__:
- d1hlb__ first appeared (with stable ids) in SCOP 1.55
- d1hlb__ appears in SCOP 1.59
- d1hlb__ appears in the current release, SCOPe 2.08, called d1hlba_
View in 3D