Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin [46522] (1 species) |
Species Innkeeper worm (Urechis caupo) [TaxId:6431] [46523] (1 PDB entry) |
Domain d1ithb_: 1ith B: [15624] complexed with cyn, hem |
PDB Entry: 1ith (more details), 2.5 Å
SCOPe Domain Sequences for d1ithb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ithb_ a.1.1.2 (B:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]} gltaaqikaiqdhwflnikgclqaaadsiffkyltaypgdlaffhkfssvplyglrsnpa ykaqtltvinyldkvvdalggnagalmkakvpshdamgitpkhfgqllklvggvfqeefs adpttvaawgdaagvlvaamk
Timeline for d1ithb_: