Lineage for d3cc7p1 (3cc7 P:1-143)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1497664Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 1497665Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
    automatically mapped to Pfam PF01280
  5. 1497666Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 1497667Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 1497668Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 1497685Domain d3cc7p1: 3cc7 P:1-143 [156233]
    Other proteins in same PDB: d3cc711, d3cc721, d3cc731, d3cc7b1, d3cc7d1, d3cc7f1, d3cc7h1, d3cc7i1, d3cc7j1, d3cc7k1, d3cc7l1, d3cc7n1, d3cc7o1, d3cc7q1, d3cc7r1, d3cc7s1, d3cc7t1, d3cc7u1, d3cc7v1, d3cc7w1, d3cc7x1, d3cc7y1, d3cc7z1
    automatically matched to d1s72p_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cc7p1

PDB Entry: 3cc7 (more details), 2.7 Å

PDB Description: Structure of Anisomycin resistant 50S Ribosomal Subunit: 23S rRNA mutation C2487U
PDB Compounds: (P:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d3cc7p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc7p1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d3cc7p1:

Click to download the PDB-style file with coordinates for d3cc7p1.
(The format of our PDB-style files is described here.)

Timeline for d3cc7p1: