Class a: All alpha proteins [46456] (284 folds) |
Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily) multihelical; consists of two different 3-helical domains connected by a long, partly helical linker |
Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) |
Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein) |
Protein Ribosomal protein L19 (L19e) [48142] (1 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries) Uniprot P14119 |
Domain d3cc4p1: 3cc4 P:1-143 [156209] Other proteins in same PDB: d3cc411, d3cc421, d3cc431, d3cc4b1, d3cc4d1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4j1, d3cc4k1, d3cc4l1, d3cc4n1, d3cc4o1, d3cc4q1, d3cc4r1, d3cc4s1, d3cc4t1, d3cc4u1, d3cc4v1, d3cc4w1, d3cc4x1, d3cc4y1, d3cc4z1 automatically matched to d1s72p_ complexed with 1ma, anm, cd, cl, k, mg, na, omg, omu, psu, sr, ur3 |
PDB Entry: 3cc4 (more details), 2.7 Å
SCOP Domain Sequences for d3cc4p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cc4p1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui [TaxId: 2238]} tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr dlydkagggefdsvadleryida
Timeline for d3cc4p1: