SCOP 1.75: Domain d3cc4z1: 3cc4 Z:35-106

Lineage for d3cc4z1 (3cc4 Z:35-106)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)

6. Protein Ribosomal protein L37ae [57831] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
   Uniprot P60619

8. Domain d3cc4z1: 3cc4 Z:35-106 [156219]
   Other proteins in same PDB: d3cc411, d3cc421, d3cc431, d3cc4b1, d3cc4d1, d3cc4f1, d3cc4h1, d3cc4i1, d3cc4j1, d3cc4k1, d3cc4l1, d3cc4n1, d3cc4o1, d3cc4p1, d3cc4q1, d3cc4r1, d3cc4s1, d3cc4t1, d3cc4u1, d3cc4v1, d3cc4w1, d3cc4x1, d3cc4y1
   automatically matched to d1s72z_
   complexed with 1ma, anm, cd, cl, k, mg, na, omg, omu, psu, sr, ur3

Details for d3cc4z1

PDB Entry: 3cc4, 2.7 Å

PDB Description: co-crystal structure of anisomycin bound to the 50s ribosomal subunit

PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOP Domain Sequences for d3cc4z1:

Sequence; same for both SEQRES and ATOM records:

>d3cc4z1 g.41.8.1 (Z:35-106) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
sgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsyk
petpggktvrrs

Timeline for d3cc4z1:

• d3cc4z1 is new in SCOP 1.75
  
• d3cc4z1 appears in SCOPe 2.01
  
• d3cc4z1 appears in the current release, SCOPe 2.08