Lineage for d1f5pd_ (1f5p D:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 275747Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 276400Protein Lamprey globin [46518] (2 species)
  7. 276414Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)
  8. 276437Domain d1f5pd_: 1f5p D: [15619]

Details for d1f5pd_

PDB Entry: 1f5p (more details), 2.9 Å

PDB Description: 2.9 angstrom crystal structure of lamprey hemoglobin that has been exposed to carbon monoxide.

SCOP Domain Sequences for d1f5pd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5pd_ a.1.1.2 (D:) Lamprey globin {Sea lamprey (Petromyzon marinus)}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOP Domain Coordinates for d1f5pd_:

Click to download the PDB-style file with coordinates for d1f5pd_.
(The format of our PDB-style files is described here.)

Timeline for d1f5pd_: