Lineage for d3c5zd1 (3c5z D:121-217)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784902Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 784971Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (16 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 784979Domain d3c5zd1: 3c5z D:121-217 [155955]
    Other proteins in same PDB: d3c5zc1, d3c5zc2, d3c5zd2, d3c5zg1, d3c5zg2, d3c5zh2
    automatically matched to d1lnub1

Details for d3c5zd1

PDB Entry: 3c5z (more details), 2.55 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr b3k506
PDB Compounds: (D:) 3K peptide, Linker, and H-2 class II histocompatibility antigen (A beta chain)

SCOP Domain Sequences for d3c5zd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c5zd1 b.1.1.2 (D:121-217) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvewka

SCOP Domain Coordinates for d3c5zd1:

Click to download the PDB-style file with coordinates for d3c5zd1.
(The format of our PDB-style files is described here.)

Timeline for d3c5zd1: