Lineage for d3c5zh2 (3c5z H:1-120)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856861Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 856943Species Mouse (Mus musculus), I-AB [TaxId:10090] [88828] (5 PDB entries)
  8. 856946Domain d3c5zh2: 3c5z H:1-120 [155960]
    Other proteins in same PDB: d3c5zc1, d3c5zc2, d3c5zd1, d3c5zg1, d3c5zg2, d3c5zh1
    automatically matched to d1lnub2

Details for d3c5zh2

PDB Entry: 3c5z (more details), 2.55 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr b3k506
PDB Compounds: (H:) 3K peptide, Linker, and H-2 class II histocompatibility antigen (A beta chain)

SCOP Domain Sequences for d3c5zh2:

Sequence, based on SEQRES records: (download)

>d3c5zh2 d.19.1.1 (H:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]}
feaqkakankavdggggslvprgsggggserhfvyqfmgecyftngtqriryvtryiynr
eeyvrydsdvgehravtelgrpdaeywnsqpeilertraeldtvcrhnyegpethtslrr

Sequence, based on observed residues (ATOM records): (download)

>d3c5zh2 d.19.1.1 (H:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]}
feaqkakankavdgerhfvyqfmgecyftngtqriryvtryiynreeyvrydsdvgehra
vtelgrpdaeywnsqpeilertraeldtvcrhnyegpethtslrr

SCOP Domain Coordinates for d3c5zh2:

Click to download the PDB-style file with coordinates for d3c5zh2.
(The format of our PDB-style files is described here.)

Timeline for d3c5zh2: