Lineage for d3c43b2 (3c43 B:509-766)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1382311Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1382312Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1383605Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 1383612Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 1383613Species Human (Homo sapiens) [TaxId:9606] [82499] (68 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 1383657Domain d3c43b2: 3c43 B:509-766 [155927]
    Other proteins in same PDB: d3c43a1, d3c43b1
    automated match to d1orva2
    complexed with 315, nag

Details for d3c43b2

PDB Entry: 3c43 (more details), 2.3 Å

PDB Description: human dipeptidyl peptidase iv/cd26 in complex with a flouroolefin inhibitor
PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3c43b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c43b2 c.69.1.24 (B:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d3c43b2:

Click to download the PDB-style file with coordinates for d3c43b2.
(The format of our PDB-style files is described here.)

Timeline for d3c43b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c43b1