SCOP 1.75: Domain d3c2sa1: 3c2s A:236-339

Lineage for d3c2sa1 (3c2s A:236-339)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (28 PDB entries)
   Uniprot P01857 #118-327
   Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d3c2sa1: 3c2s A:236-339 [155885]
   Other proteins in same PDB: d3c2sa2
   automatically matched to d1hzhh3
   complexed with bma, fuc, gal, man, nag, zn; mutant

Details for d3c2sa1

PDB Entry: 3c2s, 2.3 Å

PDB Description: structural characterization of a human fc fragment engineered for lack of effector functions

PDB Compounds: (A:) IGHM protein

SCOP Domain Sequences for d3c2sa1:

Sequence; same for both SEQRES and ATOM records:

>d3c2sa1 b.1.1.2 (A:236-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpasiektiska

Timeline for d3c2sa1:

• d3c2sa1 is new in SCOP 1.75
  
• d3c2sa1 appears in SCOPe 2.01
  
• d3c2sa1 appears in the current release, SCOPe 2.08