SCOP 1.73: Domain d1pbxb_: 1pbx B:

Lineage for d1pbxb_ (1pbx B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (22 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (6 PDB entries)

8. Domain d1pbxb_: 1pbx B: [15582]
   Other proteins in same PDB: d1pbxa_
   complexed with hem

Details for d1pbxb_

PDB Entry: 1pbx, 2.5 Å

PDB Description: haemoglobin of the antarctic fish pagothenia bernacchii: amino acid sequence, oxygen equilibria and crystal structure of its carbonmonoxy derivative

PDB Compounds: (B:) hemoglobin (carbonmonoxy) (beta chain)

SCOP Domain Sequences for d1pbxb_:

Sequence; same for both SEQRES and ATOM records:

>d1pbxb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

Timeline for d1pbxb_:

• d1pbxb_ first appeared (with stable ids) in SCOP 1.55
  
• d1pbxb_ appears in SCOP 1.71
  
• d1pbxb_ appears in SCOP 1.75
  
• d1pbxb_ appears in the current release, SCOPe 2.08