Lineage for d1pbxb_ (1pbx B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 287Protein Hemoglobin, beta-chain [46500] (15 species)
  7. 288Species Antarctic fish (Pagothenia bernacchii) [46511] (2 PDB entries)
  8. 289Domain d1pbxb_: 1pbx B: [15582]
    Other proteins in same PDB: d1pbxa_

Details for d1pbxb_

PDB Entry: 1pbx (more details), 2.5 Å

PDB Description: haemoglobin of the antarctic fish pagothenia bernacchii: amino acid sequence, oxygen equilibria and crystal structure of its carbonmonoxy derivative

SCOP Domain Sequences for d1pbxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbxb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Pagothenia bernacchii)}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

SCOP Domain Coordinates for d1pbxb_:

Click to download the PDB-style file with coordinates for d1pbxb_.
(The format of our PDB-style files is described here.)

Timeline for d1pbxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pbxa_