Lineage for d1ouub_ (1ouu B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2300465Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2301223Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [46510] (2 PDB entries)
  8. 2301225Domain d1ouub_: 1ouu B: [15580]
    Other proteins in same PDB: d1ouua_, d1ouuc_
    complexed with cmo, hem

Details for d1ouub_

PDB Entry: 1ouu (more details), 2.5 Å

PDB Description: carbonmonoxy trout hemoglobin i
PDB Compounds: (B:) hemoglobin I

SCOPe Domain Sequences for d1ouub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ouub_ a.1.1.2 (B:) Hemoglobin, beta-chain {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
vewtdaekstisavwgkvnideigplalarvlivypwtqryfgsfgnvstpaaimgnpkv
aahgkvvcgaldkavknmgnilatykslsethanklfvdpdnfrvladvltiviaakfga
sftpeiqatwqkfmkvvvaamgsryf

SCOPe Domain Coordinates for d1ouub_:

Click to download the PDB-style file with coordinates for d1ouub_.
(The format of our PDB-style files is described here.)

Timeline for d1ouub_: