SCOPe 2.08: Domain d3bw9a1: 3bw9 A:182-276

Lineage for d3bw9a1 (3bw9 A:182-276)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3bw9a1: 3bw9 A:182-276 [155680]
   Other proteins in same PDB: d3bw9a2, d3bw9b2, d3bw9b3
   automated match to d1a9ea1

Details for d3bw9a1

PDB Entry: 3bw9, 1.75 Å

PDB Description: crystal structure of hla b*3508 in complex with a hcmv 12-mer peptide from the pp65 protein

PDB Compounds: (A:) HLA class I histocompatibility antigen, B-35 alpha chain

SCOPe Domain Sequences for d3bw9a1:

Sequence; same for both SEQRES and ATOM records:

>d3bw9a1 b.1.1.0 (A:182-276) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

Timeline for d3bw9a1:

• d3bw9a1 first appeared in SCOP 1.75
  
• d3bw9a1 appears in SCOPe 2.07