SCOPe 2.07: Domain d3buza2: 3buz A:210-413

Lineage for d3buza2 (3buz A:210-413)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein Enzymatic component (Ia) of iota-toxin [82812] (1 species)
   mammalian-targeted relative of VIP2; C-terminal domain is catalytic, N-terminal domain interacts with Ib (binding component)

7. Species Clostridium perfringens [TaxId:1502] [82813] (3 PDB entries)

8. Domain d3buza2: 3buz A:210-413 [155657]
   Other proteins in same PDB: d3buzb1, d3buzb2
   automated match to d1giqa2
   complexed with atp, ca, lar, tad

Details for d3buza2

PDB Entry: 3buz, 2.81 Å

PDB Description: Crystal structure of ia-bTAD-actin complex

PDB Compounds: (A:) Iota toxin component Ia

SCOPe Domain Sequences for d3buza2:

Sequence; same for both SEQRES and ATOM records:

>d3buza2 d.166.1.1 (A:210-413) Enzymatic component (Ia) of iota-toxin {Clostridium perfringens [TaxId: 1502]}
sldfkddvskgdlwgkenysdwsnkltpneladvndymrggytainnylisngplnnpnp
eldskvnnienalkltpipsnlivyrrsgpqefgltltspeydfnkienidafkekwegk
vitypnfistsigsvnmsafakrkiilrinipkdspgaylsaipgyageyevllnhgskf
kinkvdsykdgtvtklildatlin

Timeline for d3buza2:

• d3buza2 first appeared in SCOP 1.75
  
• d3buza2 appears in SCOPe 2.06
  
• d3buza2 appears in the current release, SCOPe 2.08