Lineage for d1g09d_ (1g09 D:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 208554Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 208555Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 208567Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 208921Protein Hemoglobin, beta-chain [46500] (18 species)
  7. 208939Species Cow (Bos taurus) [TaxId:9913] [46506] (5 PDB entries)
  8. 208945Domain d1g09d_: 1g09 D: [15564]
    Other proteins in same PDB: d1g09a_, d1g09c_
    complexed with cmo, hem

Details for d1g09d_

PDB Entry: 1g09 (more details), 2.04 Å

PDB Description: carbonmonoxy liganded bovine hemoglobin ph 7.2

SCOP Domain Sequences for d1g09d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g09d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Cow (Bos taurus)}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

SCOP Domain Coordinates for d1g09d_:

Click to download the PDB-style file with coordinates for d1g09d_.
(The format of our PDB-style files is described here.)

Timeline for d1g09d_: