SCOPe 2.08: Domain d3bmva1: 3bmv A:496-578

Lineage for d3bmva1 (3bmv A:496-578)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
   follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases

7. Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49220] (4 PDB entries)

8. Domain d3bmva1: 3bmv A:496-578 [155416]
   Other proteins in same PDB: d3bmva2, d3bmva3, d3bmva4
   automated match to d3bmva1
   complexed with ca, gol, so4; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d3bmva1

PDB Entry: 3bmv, 1.6 Å

PDB Description: cyclodextrin glycosyl transferase from thermoanerobacterium thermosulfurigenes em1 mutant s77p

PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d3bmva1:

Sequence; same for both SEQRES and ATOM records:

>d3bmva1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
snsplighvgptmtkagqtitidgrgfgttsgqvlfgstagtivswddtevkvkvpsvtp
gkynislktssgatsntynnini

Timeline for d3bmva1:

• d3bmva1 first appeared in SCOP 1.75
  
• d3bmva1 appears in SCOPe 2.07