SCOPe 2.07: Domain d3bjpa2: 3bjp A:137-295

Lineage for d3bjpa2 (3bjp A:137-295)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
   automatically mapped to Pfam PF01014

6. Protein Urate oxidase (uricase) [55634] (3 species)
   duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16

7. Species Aspergillus flavus [TaxId:5059] [55635] (71 PDB entries)

8. Domain d3bjpa2: 3bjp A:137-295 [155337]
   automated match to d1r4ua2
   complexed with ace, cyn, na, urc

Details for d3bjpa2

PDB Entry: 3bjp, 1.8 Å

PDB Description: Urate oxidase cyanide uric acid ternary complex

PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d3bjpa2:

Sequence; same for both SEQRES and ATOM records:

>d3bjpa2 d.96.1.4 (A:137-295) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]}
gkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilstdvdatwqwknfsglqe
vrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkh
yfeidlswhkglqntgknaevfapqsdpnglikctvgrs

Timeline for d3bjpa2:

• d3bjpa2 first appeared in SCOP 1.75
  
• d3bjpa2 appears in SCOPe 2.06
  
• d3bjpa2 appears in the current release, SCOPe 2.08