Lineage for d3bima_ (3bim A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552337Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2552338Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2552339Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2552340Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. 2552341Species Human (Homo sapiens) [TaxId:9606] [102923] (33 PDB entries)
  8. 2552400Domain d3bima_: 3bim A: [155311]
    automated match to d1r2ba_
    protein/DNA complex

Details for d3bima_

PDB Entry: 3bim (more details), 2.6 Å

PDB Description: crystal structure of the bcl6 btb domain dimer in complex with the bcor bbd corepressor peptide
PDB Compounds: (A:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d3bima_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bima_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
adsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
lkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkf
ikase

SCOPe Domain Coordinates for d3bima_:

Click to download the PDB-style file with coordinates for d3bima_.
(The format of our PDB-style files is described here.)

Timeline for d3bima_: