Lineage for d3bhub2 (3bhu B:309-432)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331190Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2331191Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2331192Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2331205Protein Cyclin A [47956] (2 species)
  7. 2331206Species Cow (Bos taurus) [TaxId:9913] [47958] (11 PDB entries)
  8. 2331240Domain d3bhub2: 3bhu B:309-432 [155282]
    Other proteins in same PDB: d3bhua1, d3bhua2, d3bhuc1, d3bhuc2
    automated match to d1vina2
    complexed with mg, mhr

Details for d3bhub2

PDB Entry: 3bhu (more details), 2.3 Å

PDB Description: structure of phosphorylated thr160 cdk2/cyclin a in complex with the inhibitor meriolin 5
PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d3bhub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bhub2 a.74.1.1 (B:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
ptinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvt
gqswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppe
tlnv

SCOPe Domain Coordinates for d3bhub2:

Click to download the PDB-style file with coordinates for d3bhub2.
(The format of our PDB-style files is described here.)

Timeline for d3bhub2: