Lineage for d3beca1 (3bec A:263-355)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430164Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 2430165Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) (S)
  5. 2430166Family b.105.1.1: PBP5 C-terminal domain-like [69190] (2 proteins)
    automatically mapped to Pfam PF07943
  6. 2430173Protein Penicillin-binding protein 5, C-terminal domain [69191] (1 species)
  7. 2430174Species Escherichia coli [TaxId:562] [69192] (11 PDB entries)
  8. 2430175Domain d3beca1: 3bec A:263-355 [155181]
    Other proteins in same PDB: d3beca2
    automated match to d1nzoa1
    complexed with gol, hj2

Details for d3beca1

PDB Entry: 3bec (more details), 1.6 Å

PDB Description: Crystal structure of E. coli penicillin-binding protein 5 in complex with a peptide-mimetic cephalosporin
PDB Compounds: (A:) penicillin-binding protein 5

SCOPe Domain Sequences for d3beca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3beca1 b.105.1.1 (A:263-355) Penicillin-binding protein 5, C-terminal domain {Escherichia coli [TaxId: 562]}
fetvnplkvgkefasepvwfgdsdraslgvdkdvyltiprgrmkdlkasyvlnsselhap
lqknqvvgtinfqldgktieqrplvvlqeipeg

SCOPe Domain Coordinates for d3beca1:

Click to download the PDB-style file with coordinates for d3beca1.
(The format of our PDB-style files is described here.)

Timeline for d3beca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3beca2