Lineage for d3bdwc_ (3bdw C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607290Protein CD94 [56440] (1 species)
  7. 2607291Species Human (Homo sapiens) [TaxId:9606] [56441] (4 PDB entries)
  8. 2607293Domain d3bdwc_: 3bdw C: [155162]
    Other proteins in same PDB: d3bdwb_, d3bdwd_
    automated match to d1b6ea_

Details for d3bdwc_

PDB Entry: 3bdw (more details), 2.5 Å

PDB Description: human cd94/nkg2a
PDB Compounds: (C:) Natural killer cells antigen CD94

SCOPe Domain Sequences for d3bdwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdwc_ d.169.1.1 (C:) CD94 {Human (Homo sapiens) [TaxId: 9606]}
ccscqekwvgyrcncyfisseqktwnesrhlcasqkssllqlqntdeldfmsssqqfywi
glsyseehtawlwengsalsqylfpsfetfntknciaynpngnaldescedknryickqq
li

SCOPe Domain Coordinates for d3bdwc_:

Click to download the PDB-style file with coordinates for d3bdwc_.
(The format of our PDB-style files is described here.)

Timeline for d3bdwc_: