Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein CD94 [56440] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [56441] (4 PDB entries) |
Domain d3bdwc_: 3bdw C: [155162] Other proteins in same PDB: d3bdwb_, d3bdwd_ automated match to d1b6ea_ |
PDB Entry: 3bdw (more details), 2.5 Å
SCOPe Domain Sequences for d3bdwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bdwc_ d.169.1.1 (C:) CD94 {Human (Homo sapiens) [TaxId: 9606]} ccscqekwvgyrcncyfisseqktwnesrhlcasqkssllqlqntdeldfmsssqqfywi glsyseehtawlwengsalsqylfpsfetfntknciaynpngnaldescedknryickqq li
Timeline for d3bdwc_: