![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.70: Nucleoside hydrolase [53589] (1 superfamily) core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest |
![]() | Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) ![]() |
![]() | Family c.70.1.0: automated matches [191403] (1 protein) not a true family |
![]() | Protein automated matches [190539] (6 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189208] (2 PDB entries) |
![]() | Domain d3b9xb_: 3b9x B: [155026] automated match to d3g5id_ complexed with ca, nos, tam |
PDB Entry: 3b9x (more details), 2.3 Å
SCOPe Domain Sequences for d3b9xb_:
Sequence, based on SEQRES records: (download)
>d3b9xb_ c.70.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} krkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinvp vyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdgditlv pvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgv plvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggpvhdat cigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglv eecvrgyi
>d3b9xb_ c.70.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} krkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinvp vyagmpqpimrqqivadtgldgpvfepltrqaesthavkyiidtlmasdgditlvpvgpl sniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgvplvmm gldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggpvhdatcigyl inpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglveecvr gyi
Timeline for d3b9xb_: