Lineage for d3b9jc1 (3b9j C:571-694)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647036Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1647037Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 1647038Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 1647099Protein Xanthine oxidase, domain 5 (?) [54670] (1 species)
  7. 1647100Species Cow (Bos taurus) [TaxId:9913] [54671] (11 PDB entries)
    Uniprot P80457
  8. 1647113Domain d3b9jc1: 3b9j C:571-694 [155004]
    Other proteins in same PDB: d3b9ja1, d3b9ja2, d3b9jb1, d3b9jb2, d3b9jc2, d3b9ji1, d3b9ji2, d3b9jj1, d3b9jj2, d3b9jk2
    automated match to d1fiqc1
    complexed with 290, ca, fad, fes, mos, mte

Details for d3b9jc1

PDB Entry: 3b9j (more details), 2.3 Å

PDB Description: Structure of Xanthine Oxidase with 2-hydroxy-6-methylpurine
PDB Compounds: (C:) xanthine oxidase

SCOPe Domain Sequences for d3b9jc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9jc1 d.41.1.1 (C:571-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

SCOPe Domain Coordinates for d3b9jc1:

Click to download the PDB-style file with coordinates for d3b9jc1.
(The format of our PDB-style files is described here.)

Timeline for d3b9jc1: