SCOPe 2.04: Domain d3b9ia_: 3b9i A:

Lineage for d3b9ia_ (3b9i A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [158983] (4 PDB entries)
   Uniprot Q7TS55 51-173! Uniprot Q80YG2 49-173

8. Domain d3b9ia_: 3b9i A: [154998]
   automated match to d2q8oa1

Details for d3b9ia_

PDB Entry: 3b9i, 2.49 Å

PDB Description: crystal structure of mouse gitrl at 2.5 a.

PDB Compounds: (A:) GITR ligand

SCOPe Domain Sequences for d3b9ia_:

Sequence; same for both SEQRES and ATOM records:

>d3b9ia_ b.22.1.1 (A:) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Mouse (Mus musculus) [TaxId: 10090]}
scmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyikdnapfv
vqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntywgiilmpdlp
fis

Timeline for d3b9ia_:

• d3b9ia_ first appeared in SCOP 1.75, called d3b9ia1
  
• d3b9ia_ appears in SCOPe 2.03
  
• d3b9ia_ appears in SCOPe 2.05
  
• d3b9ia_ appears in the current release, SCOPe 2.08