SCOP 1.59: Domain d2hbsb_: 2hbs B:

Lineage for d2hbsb_ (2hbs B:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Hemoglobin, beta-chain [46500] (18 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (76 PDB entries)

8. Domain d2hbsb_: 2hbs B: [15477]
   Other proteins in same PDB: d2hbsa_, d2hbsc_, d2hbse_, d2hbsg_

Details for d2hbsb_

PDB Entry: 2hbs, 2.05 Å

PDB Description: the high resolution crystal structure of deoxyhemoglobin s

SCOP Domain Sequences for d2hbsb_:

Sequence; same for both SEQRES and ATOM records:

>d2hbsb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens)}
vhltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d2hbsb_:

• d2hbsb_ first appeared (with stable ids) in SCOP 1.55
  
• d2hbsb_ appears in SCOP 1.57
  
• d2hbsb_ appears in SCOP 1.61
  
• d2hbsb_ appears in the current release, SCOPe 2.08