SCOPe 2.03: Domain d2zpya1: 2zpy A:88-198

Lineage for d2zpya1 (2zpy A:88-198)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (1 family)
   automatically mapped to Pfam PF00373

5. Family a.11.2.1: Second domain of FERM [47032] (9 proteins)

6. Protein Radixin [47035] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47036] (10 PDB entries)

8. Domain d2zpya1: 2zpy A:88-198 [154758]
   Other proteins in same PDB: d2zpya2, d2zpya3
   automatically matched to d1gc6a1

Details for d2zpya1

PDB Entry: 2zpy, 2.1 Å

PDB Description: Crystal structure of the mouse radxin FERM domain complexed with the mouse CD44 cytoplasmic peptide

PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d2zpya1:

Sequence; same for both SEQRES and ATOM records:

>d2zpya1 a.11.2.1 (A:88-198) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl

Timeline for d2zpya1:

• d2zpya1 first appeared in SCOP 1.75
  
• d2zpya1 appears in SCOPe 2.02
  
• d2zpya1 appears in SCOPe 2.04
  
• d2zpya1 appears in the current release, SCOPe 2.08