Lineage for d2zleb1 (2zle B:611-709)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538457Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1538458Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1538892Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)
  6. 1538896Protein Protease Do (DegP, HtrA), C-terminal domains [74934] (1 species)
    duplication: tandem repeat of two PDZ domains
  7. 1538897Species Escherichia coli [TaxId:562] [74935] (4 PDB entries)
  8. 1538906Domain d2zleb1: 2zle B:611-709 [154635]
    Other proteins in same PDB: d2zlea3, d2zleb3, d2zlec3, d2zlee3, d2zlef3, d2zleg3, d2zleh3, d2zlei3, d2zlej3, d2zlek3, d2zlel3, d2zlem3
    automatically matched to d1ky9b1

Details for d2zleb1

PDB Entry: 2zle (more details), 28 Å

PDB Description: cryo-em structure of degp12/omp
PDB Compounds: (B:) Protease do

SCOPe Domain Sequences for d2zleb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zleb1 b.36.1.4 (B:611-709) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}
vkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaakagikagdvitslngkpis
sfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqss

SCOPe Domain Coordinates for d2zleb1:

Click to download the PDB-style file with coordinates for d2zleb1.
(The format of our PDB-style files is described here.)

Timeline for d2zleb1: