Lineage for d2zjpn1 (2zjp N:2-118)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734855Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2734896Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
    automatically mapped to Pfam PF00453
  5. 2734897Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 2734898Protein Ribosomal protein L20 [74733] (4 species)
  7. 2734901Species Deinococcus radiodurans [TaxId:1299] [158512] (6 PDB entries)
    Uniprot Q9RSW7 2-118
  8. 2734905Domain d2zjpn1: 2zjp N:2-118 [154506]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR N:2-118
    protein/RNA complex; complexed with mg, no1, zn

Details for d2zjpn1

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (N:) 50S ribosomal protein L20

SCOPe Domain Sequences for d2zjpn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjpn1 a.144.2.1 (N:2-118) Ribosomal protein L20 {Deinococcus radiodurans [TaxId: 1299]}
praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq

SCOPe Domain Coordinates for d2zjpn1:

Click to download the PDB-style file with coordinates for d2zjpn1.
(The format of our PDB-style files is described here.)

Timeline for d2zjpn1: