![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.10: Replication initiation protein [46816] (3 proteins) duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetry |
![]() | Protein RepE54 [46817] (1 species) |
![]() | Species Escherichia coli, mini-F plasmid [TaxId:562] [46818] (2 PDB entries) |
![]() | Domain d2z9oa1: 2z9o A:21-143 [154260] automated match to d1repc1 protein/DNA complex |
PDB Entry: 2z9o (more details), 3.14 Å
SCOPe Domain Sequences for d2z9oa1:
Sequence, based on SEQRES records: (download)
>d2z9oa1 a.4.5.10 (A:21-143) RepE54 {Escherichia coli, mini-F plasmid [TaxId: 562]} sndlteaayslsrdqkrmlylfvdqirksdgtlqehdgiceihvakyaeifgltsaeask dirqalksfagkevvfyrpeedagdekgyesfpwfikrahspsrglysvhinpylipffi glq
>d2z9oa1 a.4.5.10 (A:21-143) RepE54 {Escherichia coli, mini-F plasmid [TaxId: 562]} sndlteaayslsrdqkrmlylfvdqirdgiceihvakyaeifgltsaeaskdirqalksf agkevvfyrpeedagdekgyesfpwfikrahspsrglysvhinpylipffiglq
Timeline for d2z9oa1: