Lineage for d2z6nb_ (2z6n B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1474002Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 1474003Species Aldabra giant tortoise (Geochelone gigantea) [TaxId:167804] [100977] (3 PDB entries)
    Uniprot P83133
  8. 1474005Domain d2z6nb_: 2z6n B: [154181]
    Other proteins in same PDB: d2z6na_
    automated match to d1wmub_
    complexed with cmo, hem

Details for d2z6nb_

PDB Entry: 2z6n (more details), 1.86 Å

PDB Description: crystal structure of carbonmonoxy hemoglobin d from the aldabra giant tortoise, geochelone gigantea
PDB Compounds: (B:) Hemoglobin A/D subunit beta

SCOPe Domain Sequences for d2z6nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z6nb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]}
vhwtseekqyitslwakvnvgevggealarllivypwtqrffasfgnlssanailhnakv
lahgqkvltsfgeavknldnikktfaqlselhceklhvdpenfkllgniliivlathfpk
eftpasqaawtklvnavahalalgyh

SCOPe Domain Coordinates for d2z6nb_:

Click to download the PDB-style file with coordinates for d2z6nb_.
(The format of our PDB-style files is described here.)

Timeline for d2z6nb_: