Lineage for d2z49a2 (2z49 A:151-283)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 800749Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 800938Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 800939Family b.42.2.1: Ricin B-like [50371] (10 proteins)
  6. 800984Protein Hemolytic lectin CEL-III, domains 1 and 2 [110211] (1 species)
  7. 800985Species Cucumaria echinata [TaxId:40245] [110212] (3 PDB entries)
    Uniprot Q868M7 11-442
  8. 800995Domain d2z49a2: 2z49 A:151-283 [154043]
    Other proteins in same PDB: d2z49a3, d2z49b3
    automatically matched to d1vcla2
    complexed with amg, ca, mg

Details for d2z49a2

PDB Entry: 2z49 (more details), 1.95 Å

PDB Description: crystal structure of hemolytic lectin cel-iii complexed with methyl- alpha-d-galactopylanoside
PDB Compounds: (A:) hemolytic lectin CEL-III

SCOP Domain Sequences for d2z49a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z49a2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]}
pelfygrlrneksdlcldvegsdgkgnvlmyscednldqwfryyengeivnaksgmcldv
egsdgsgnvgiyrcddlrdqmwsrpnaycngdycsflnkesnkcldvsgdqgtgdvgtwq
cdglpdqrfkwvf

SCOP Domain Coordinates for d2z49a2:

Click to download the PDB-style file with coordinates for d2z49a2.
(The format of our PDB-style files is described here.)

Timeline for d2z49a2: