Lineage for d2z33a_ (2z33 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480304Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1480305Family a.4.6.1: PhoB-like [46895] (5 proteins)
    contains 4-stranded meander beta-sheet in the N-terminal extension
  6. 1480311Protein PhoB [46898] (2 species)
  7. 1480312Species Escherichia coli [TaxId:562] [46899] (4 PDB entries)
  8. 1480318Domain d2z33a_: 2z33 A: [153956]
    automated match to d2z33a1
    protein/DNA complex

Details for d2z33a_

PDB Entry: 2z33 (more details)

PDB Description: solution structure of the dna complex of phob dna- binding/transactivation domain
PDB Compounds: (A:) phosphate regulon transcriptional regulatory protein phob

SCOPe Domain Sequences for d2z33a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z33a_ a.4.6.1 (A:) PhoB {Escherichia coli [TaxId: 562]}
maveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvwg
tnvyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf

SCOPe Domain Coordinates for d2z33a_:

Click to download the PDB-style file with coordinates for d2z33a_.
(The format of our PDB-style files is described here.)

Timeline for d2z33a_: