Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily) alpha1-beta3; 2 layers: alpha/beta; order 132 |
Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family) duplication: consists of 2 subdomains of this fold |
Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein) |
Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries) |
Domain d2z2mf1: 2z2m F:631-692 [153947] Other proteins in same PDB: d2z2mb1, d2z2me1 automatically matched to d1pmda1 complexed with cds, so4 |
PDB Entry: 2z2m (more details), 2.6 Å
SCOPe Domain Sequences for d2z2mf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z2mf1 d.11.1.1 (F:631-692) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} sqqspypmpsvkdispgdlaeelrrnlvqpivvgtgtkiknssaeegknlapnqqvlils dk
Timeline for d2z2mf1:
View in 3D Domains from other chains: (mouse over for more information) d2z2mb1, d2z2mc1, d2z2mc2, d2z2me1 |