Class a: All alpha proteins [46456] (171 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (18 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (16 species) |
Species Bar-headed goose (Anser indicus) [TaxId:8846] [46493] (3 PDB entries) |
Domain d1a4fa_: 1a4f A: [15394] Other proteins in same PDB: d1a4fb_ complexed with hem, oxy |
PDB Entry: 1a4f (more details), 2 Å
SCOP Domain Sequences for d1a4fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a4fa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Bar-headed goose (Anser indicus)} vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk kvvaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltae vhasldkflcavgtvltakyr
Timeline for d1a4fa_: