Lineage for d2yy2b_ (2yy2 B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1508295Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1508296Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1508381Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1508633Protein automated matches [190370] (1 species)
    not a true protein
  7. 1508634Species Human (Homo sapiens) [TaxId:9606] [187208] (23 PDB entries)
  8. 1508658Domain d2yy2b_: 2yy2 B: [153830]
    automated match to d2hd1a1
    complexed with ibm, mg, zn

Details for d2yy2b_

PDB Entry: 2yy2 (more details), 2.8 Å

PDB Description: Crystal structure of the human Phosphodiesterase 9A catalytic domain complexed with IBMX
PDB Compounds: (B:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d2yy2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yy2b_ a.211.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcl
leeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeiml
qplwesrdryeelkriddamkelq

SCOPe Domain Coordinates for d2yy2b_:

Click to download the PDB-style file with coordinates for d2yy2b_.
(The format of our PDB-style files is described here.)

Timeline for d2yy2b_: