Lineage for d2yx9a1 (2yx9 A:212-628)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1534928Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1534929Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 1534930Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1534931Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 1534932Species Arthrobacter globiformis [TaxId:1665] [50003] (40 PDB entries)
    Uniprot P46881 9-628
  8. 1534960Domain d2yx9a1: 2yx9 A:212-628 [153817]
    Other proteins in same PDB: d2yx9a2, d2yx9a3, d2yx9b2, d2yx9b3
    automatically matched to d1av4a1
    complexed with cu

Details for d2yx9a1

PDB Entry: 2yx9 (more details), 1.68 Å

PDB Description: crystal structure of d298k copper amine oxidase from arthrobacter globiformis
PDB Compounds: (A:) phenylethylamine oxidase

SCOPe Domain Sequences for d2yx9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yx9a1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfktgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignydygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

SCOPe Domain Coordinates for d2yx9a1:

Click to download the PDB-style file with coordinates for d2yx9a1.
(The format of our PDB-style files is described here.)

Timeline for d2yx9a1: