SCOPe 2.07: Domain d2yw6a_: 2yw6 A:

Lineage for d2yw6a_ (2yw6 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Dodecameric ferritin homolog [47250] (16 species)

7. Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries)
   Uniprot Q8VP75

8. Domain d2yw6a_: 2yw6 A: [153794]
   automated match to d1veia_
   mutant

Details for d2yw6a_

PDB Entry: 2yw6, 2.53 Å

PDB Description: Structural studies of N terminal deletion mutant of Dps from Mycobacterium smegmatis

PDB Compounds: (A:) DNA protection during starvation protein

SCOPe Domain Sequences for d2yw6a_:

Sequence; same for both SEQRES and ATOM records:

>d2yw6a_ a.25.1.1 (A:) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]}
dkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevae
riatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledl
dlvsqdlliahagelekfqwfvrahles

Timeline for d2yw6a_:

• d2yw6a_ first appeared in SCOP 1.75, called d2yw6a1
  
• d2yw6a_ appears in SCOPe 2.06
  
• d2yw6a_ appears in the current release, SCOPe 2.08