SCOP 1.75: Domain d1g0ba_: 1g0b A:

Lineage for d1g0ba_ (1g0b A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (20 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46488] (14 PDB entries)

8. Domain d1g0ba_: 1g0b A: [15375]
   Other proteins in same PDB: d1g0bb_
   complexed with cmo, hem

Details for d1g0ba_

PDB Entry: 1g0b, 1.9 Å

PDB Description: carbonmonoxy liganded equine hemoglobin ph 8.5

PDB Compounds: (A:) hemoglobin alpha chain

SCOP Domain Sequences for d1g0ba_:

Sequence; same for both SEQRES and ATOM records:

>d1g0ba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

Timeline for d1g0ba_:

• d1g0ba_ first appeared (with stable ids) in SCOP 1.55
  
• d1g0ba_ appears in SCOP 1.73
  
• d1g0ba_ appears in SCOPe 2.01
  
• d1g0ba_ appears in the current release, SCOPe 2.08