Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species) |
Species Escherichia coli [TaxId:562] [51802] (12 PDB entries) Uniprot P06977 |
Domain d2vyva1: 2vyv A:0-146,A:311-329 [153715] Other proteins in same PDB: d2vyva2, d2vyvb2, d2vyvc2 automated match to d1s7ca1 complexed with 1gp, fmt, nad |
PDB Entry: 2vyv (more details), 2.38 Å
SCOPe Domain Sequences for d2vyva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vyva1 c.2.1.3 (A:0-146,A:311-329) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg pskdntpmfvkganfdkyagqdivsnaXdnetgysnkvldliahisk
Timeline for d2vyva1:
View in 3D Domains from other chains: (mouse over for more information) d2vyvb1, d2vyvb2, d2vyvc1, d2vyvc2 |