Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins) |
Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (8 PDB entries) Uniprot Q89ZI2 25-147 |
Domain d2vvnb3: 2vvn B:4-126 [153639] Other proteins in same PDB: d2vvna1, d2vvna2, d2vvnb1, d2vvnb2 automatically matched to 2J4G A:4-126 complexed with gol, nh4, nht |
PDB Entry: 2vvn (more details), 1.85 Å
SCOPe Domain Sequences for d2vvnb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vvnb3 d.92.2.3 (B:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd yps
Timeline for d2vvnb3: