Lineage for d2vumg1 (2vum G:1-171)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2649260Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 2649261Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 2649262Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 2649263Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 2649264Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 2649268Domain d2vumg1: 2vum G:1-171 [153552]
    Other proteins in same PDB: d2vumb1, d2vumf1, d2vumh1, d2vumj1, d2vuml1
    automatically matched to d1wcmg_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2vumg1

PDB Entry: 2vum (more details), 3.4 Å

PDB Description: alpha-amanitin inhibited complete rna polymerase ii elongation complex
PDB Compounds: (G:) DNA-directed RNA polymerase II subunit RPB7

SCOPe Domain Sequences for d2vumg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vumg1 i.8.1.1 (G:1-171) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
ilptdgsaefnvkyravvfkpfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdlt
fnagsnppsyqssedvitiksrirvkiegcisqvssihaigsikedylgai

SCOPe Domain Coordinates for d2vumg1:

Click to download the PDB-style file with coordinates for d2vumg1.
(The format of our PDB-style files is described here.)

Timeline for d2vumg1: