Class a: All alpha proteins [46456] (171 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (18 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (16 species) |
Species Human (Homo sapiens) [TaxId:9606] [46487] (97 PDB entries) |
Domain d1abya2: 1aby A:143-283 [15350] Other proteins in same PDB: d1abyb_, d1abyd_ recombinant hemoglobin; two alpha subunits fused in a single chain complexed with cyn, hem; mutant |
PDB Entry: 1aby (more details), 2.6 Å
SCOP Domain Sequences for d1abya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1abya2 a.1.1.2 (A:143-283) Hemoglobin, alpha-chain {Human (Homo sapiens)} vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d1abya2: