![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) ![]() fold elaborated with additional structures |
![]() | Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
![]() | Protein Ribosomal protein S2 [52315] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries) Uniprot P80371 |
![]() | Domain d2vqeb1: 2vqe B:7-241 [153427] Other proteins in same PDB: d2vqed1, d2vqee1, d2vqef1, d2vqeg1, d2vqeh1, d2vqei1, d2vqej1, d2vqek1, d2vqel1, d2vqem1, d2vqen1, d2vqeo1, d2vqep1, d2vqeq1, d2vqer1, d2vqes1, d2vqet1, d2vqeu1 automatically matched to d1i94b_ complexed with k, mg, par, tm2, zn |
PDB Entry: 2vqe (more details), 2.5 Å
SCOP Domain Sequences for d2vqeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqeb1 c.23.15.1 (B:7-241) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]} vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe
Timeline for d2vqeb1: