Lineage for d2vqen1 (2vqe N:2-61)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892407Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 892408Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) (S)
  5. 892700Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 892701Protein Ribosomal protein S14 [57753] (2 species)
  7. 892727Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 892729Domain d2vqen1: 2vqe N:2-61 [153438]
    Other proteins in same PDB: d2vqeb1, d2vqed1, d2vqee1, d2vqef1, d2vqeg1, d2vqeh1, d2vqei1, d2vqej1, d2vqek1, d2vqel1, d2vqem1, d2vqeo1, d2vqep1, d2vqeq1, d2vqer1, d2vqes1, d2vqet1, d2vqeu1
    automatically matched to d1fjgn_
    complexed with k, mg, par, tm2, zn

Details for d2vqen1

PDB Entry: 2vqe (more details), 2.5 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (N:) 30s ribosomal protein s14 type z

SCOP Domain Sequences for d2vqen1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqen1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d2vqen1:

Click to download the PDB-style file with coordinates for d2vqen1.
(The format of our PDB-style files is described here.)

Timeline for d2vqen1: