Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein automated matches [190057] (27 species) not a true protein |
Species Bacteroides thetaiotaomicron [TaxId:226186] [255614] (7 PDB entries) |
Domain d2votb5: 2vot B:331-678 [153388] Other proteins in same PDB: d2vota1, d2vota2, d2vota3, d2vota4, d2votb1, d2votb2, d2votb3, d2votb4, d2votb6 automated match to d2je8a5 complexed with br, cl, edo, nhv |
PDB Entry: 2vot (more details), 1.95 Å
SCOPe Domain Sequences for d2votb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2votb5 c.1.8.3 (B:331-678) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} rtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkeanmn mvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrlrn haslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrfyv hsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemktiaaf aapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhgle ahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafap
Timeline for d2votb5: