Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins) barrel, closed; n=5, S=8 |
Protein Exosome complex exonuclease RRP44 [159104] (1 species) member or the RNase II family; contains 3 S1-like domains; two of them are in tandem N-terminally to the catalytic domain and one is C-terminally to the catalytic domain that also contains an OB-fold |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159105] (1 PDB entry) Uniprot Q08162 252-399! Uniprot Q08162 400-494! Uniprot Q08162 911-998 |
Domain d2vnud1: 2vnu D:400-494 [153344] Other proteins in same PDB: d2vnud4 protein/RNA complex; complexed with 1pe, mg, na |
PDB Entry: 2vnu (more details), 2.3 Å
SCOPe Domain Sequences for d2vnud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vnud1 b.40.4.5 (D:400-494) Exosome complex exonuclease RRP44 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} wrqyvgqlapssvdpqssstqnvfvilmdkclpkvrirtrraaelldkrivisidswptt hkyplghfvrdlgtiesaqaetealllehdveyrp
Timeline for d2vnud1: