Lineage for d2vnud1 (2vnu D:400-494)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399379Protein Exosome complex exonuclease RRP44 [159104] (1 species)
    member or the RNase II family; contains 3 S1-like domains; two of them are in tandem N-terminally to the catalytic domain and one is C-terminally to the catalytic domain that also contains an OB-fold
  7. 2399380Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159105] (1 PDB entry)
    Uniprot Q08162 252-399! Uniprot Q08162 400-494! Uniprot Q08162 911-998
  8. 2399381Domain d2vnud1: 2vnu D:400-494 [153344]
    Other proteins in same PDB: d2vnud4
    protein/RNA complex; complexed with 1pe, mg, na

Details for d2vnud1

PDB Entry: 2vnu (more details), 2.3 Å

PDB Description: crystal structure of sc rrp44
PDB Compounds: (D:) exosome complex exonuclease rrp44

SCOPe Domain Sequences for d2vnud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vnud1 b.40.4.5 (D:400-494) Exosome complex exonuclease RRP44 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
wrqyvgqlapssvdpqssstqnvfvilmdkclpkvrirtrraaelldkrivisidswptt
hkyplghfvrdlgtiesaqaetealllehdveyrp

SCOPe Domain Coordinates for d2vnud1:

Click to download the PDB-style file with coordinates for d2vnud1.
(The format of our PDB-style files is described here.)

Timeline for d2vnud1: