Lineage for d2vmfa4 (2vmf A:28-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384714Species Bacteroides thetaiotaomicron [TaxId:226186] [255611] (7 PDB entries)
  8. 2384723Domain d2vmfa4: 2vmf A:28-219 [153319]
    Other proteins in same PDB: d2vmfa1, d2vmfa2, d2vmfa3, d2vmfa5, d2vmfb1, d2vmfb2, d2vmfb3, d2vmfb5, d2vmfb6
    automated match to d2je8a4
    complexed with br, cl, edo, mvl

Details for d2vmfa4

PDB Entry: 2vmf (more details), 2.1 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (A:) beta-mannosidase

SCOPe Domain Sequences for d2vmfa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vmfa4 b.18.1.0 (A:28-219) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
gvwrpvtlrfyd

SCOPe Domain Coordinates for d2vmfa4:

Click to download the PDB-style file with coordinates for d2vmfa4.
(The format of our PDB-style files is described here.)

Timeline for d2vmfa4: